Os04g0653000

From RiceWiki
Revision as of 08:42, 4 June 2014 by Suchao13 (talk | contribs) (References)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here.

  • EG2(extra glume 2)is a JA signalling repressor that interacts with a putative JA receptor, OsCOI1b, to trigger OsJAZ1’s degradation during spikelet development.
  • Its high sequence similarity with the Arabidopsis JAZ proteins so also called OsJAZ1.
  • It belong to TIFY family so also called TIFY family.

Expression

Please input expression information here.

EG2 expressed ubiquitously in the plant, from roots, stems and leaves, to spikelets and seeds. Eg-1.jpg

Mutation and Phenotype

Please input information here.

The EG2 gene was mapped to chromosome 4 between CQQ2 and CQQ3, two In-Del markers that define a 2.2 cM.

Eg-2.jpg

The mutation of EG2 is eg2-1D, which caused by C-to-G transition, resulting in a substitution of Ala by Gly in the fifth amino acid of the Jas domain. This motif was known to be critical for JAZ’s interaction with the JA receptor COI1.

Eg-3.jpg

mutants displayed defects in spikelet development,including extra glume-like structures between the sterile lemma and lemma and altered floral organ numbers and identities.

Eg-4.jpgEg-5.jpg

EG2 is a repressor of JA response

Please input information here.

yeast two-hybrid (Y2H) assays show OsJAZ1 can interact with OsCOI1b, and the interaction was dependent on JA-Ile’s mimic, coronatine(COR), but not JA or MeJA. No interaction was observed between OsJAZ1 and OsCOI1a or OsCOI1c.

Eg-6.jpg

Furthermore, the Ala-to-Gly mutation in the Jas domain of OsJAZ1 in eg2-1D blocked the interact between OsJAZ1 and JOsCOI1b, suggesting that the Jas domain is required for the interaction between OsJAZ1 and OsCOI1b. because osjaz1-1D can't interact with OsCOI1b, so it can't be JA-dependent proteasome-mediated degradation.


Eg-7.jpg

JA regulates early spikelet development possibly by activating the expression of OsMADS1 through OsMYC2, which is directly regulates OsMADS1 expression.And, OsJAZ1 interacts with OsMYC2 and suppresses the activity of OsMYC2 in triggering the transcription of OsMADS1.Both OsJAZ1 and osjaz1-1D interacted with OsMYC2, and the interaction required the Jas domain.

Inconclude,eg2-1D can't interact with OsCOI1b, so it not degradation, but it also can interact with OsMYC2 to block OsMYC2 regulates the OsMADS1 expression.

Eg-9.jpg

Extend knowledge

Please input information here.

The TIFY family is a novel plant-specific gene family involved in the regulation of diverse plant-specific biologic processes. This report identifies 20 TIFY genes in rice, On the basis of their protein structures, members of the TIFY family can be divided into two groups. Almost all the OsTIFY genes were responsive to one or more abiotic stresses including drought, salinity, and low temperature.Suggesting that the OsTIFY family may have important roles in response to abiotic stresses.

To analyze the evolutionary relationships of the OsTIFY genes, a phylogenetic tree was generated using the sequence alignments of 38 full-length TIFY proteins, including 20 from rice and 18 from Arabidopsis thaliana. The result show in the picture.

Eg-10.jpg

Labs working on this gene

Please input related labs here.

  • State Key Laboratory of Hybrid Rice, School of Life Sciences and Biotechnology, Shanghai Jiao Tong University
  • Jiangsu Key Laboratory for Eco-Agricultural Biotechnology around Hongze Lake, Huaiyin Normal University
  • Department of Energy Plant Research Laboratory, Michigan State University
  • National Key Laboratory of Crop Genetic Improvement,National Center of Plant Gene Research,Huazhong Agricultural University

References

Please input cited references here.

  • Qiang Cai, Zheng Yuan, Mingjiao Chen, et al. Jasmonic acid regulates spikelet development in rice. NATURE COMMUNICATIONS, 2014
  • Haiyan Ye, Hao Du, Ning Tang, et al. Identification and expression profiling analysis of TIFY family genes involved in stress and phytohormone responses in rice. Plant Mol Biol, 2009

Structured Information

Gene Name

Os04g0653000

Description

The start codon is not identified.

Version

NM_001060638.1 GI:115461005 GeneID:4337240

Length

3445 bp

Definition

Oryza sativa Japonica Group Os04g0653000, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 4

Location

Chromosome 4:33705210..33708654

Sequence Coding Region

33705211..33705317,33707373..33707475,33707567..33707792,33707906..33707963,33708275..33708365

Expression

GEO Profiles:Os04g0653000

Genome Context

<gbrowseImage1> name=NC_008397:33705210..33708654 source=RiceChromosome04 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008397:33705210..33708654 source=RiceChromosome04 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>ggagaggagaggaaggaggaagaggtggtggtggaggagaagagccatcagcagcagcagcagcaaggggaggaggagctcgtcggcctctcgctcgccggcggcaggcccaaagtatttccaatgtcgagccctccacctaatccttcgcaacttacaattttctatggtggatcagtatgtgtttatgactcagtgccgccagagaaggctcaagcaatcatgcttattgccgcagcagctgctgcagcggcgtctgccaccaaaagcaatgctgccattgctgttaagccccctgtgatgcctgcagccaatgctacccaagcagcagtctctcctgtgctcacaagatcgctctcattgcagagcacttctgtagcaactggacaacctcaagttgccgctgaccctagctcaatttgcaagctccaggctgatctccccattgccaggaggcactcccttcagcgcttcctagagaaacgccgtgacaggttggtgagcaaagctccatatcccacaaaatcctccgagggcatggaagcatcagggatggaagtaactgctgagggcaaggcccagtaa</cdnaseq>

Protein Sequence

<aaseq>GEERKEEEVVVEEKSHQQQQQQGEEELVGLSLAGGRPKVFPMSS PPPNPSQLTIFYGGSVCVYDSVPPEKAQAIMLIAAAAAAAASATKSNAAIAVKPPVMP AANATQAAVSPVLTRSLSLQSTSVATGQPQVAADPSSICKLQADLPIARRHSLQRFLE KRRDRLVSKAPYPTKSSEGMEASGMEVTAEGKAQ</aaseq>

Gene Sequence

<dnaseqindica>2..108#2164..2266#2358..2583#2697..2754#3066..3156#gggagaggagaggaaggaggaagaggtggtggtggaggagaagagccatcagcagcagcagcagcaaggggaggaggagctcgtcggcctctcgctcgccggcggcaggtagttttccggctccgccttctcctctcgcaagtcgagtcctattcagctttgggttgatcgattgggtcgcgggagagagagtatttggttggttgttcgggaaatgcatctcgcgcgggattctagccgcttttcagttcatagtatcgccccttctccgagaactcgccgccggggagccgcttcctgctgggagccgagcggcgccgcagccgcctccgaagtggtttaccggaggggatggattttctccggtactggactcctggtgtttgaatttttgggtggaaccggagactctttttttggtcgggtgaaattccttggaccgaccaaaaaaatctcgaatccactcggagtttcctccgttccagatggagctcttgcgttgaaaattttcctaaaaatagagtcaaaatgtttcgacttcgagttaagagtccaccctacaccgagttgcaactttcccttttttacgagttggtgtaatcatggaagagcccttagctttgctgcagtggatcaaattggtgggggttcttgcctaggtcatgtgaagattcttctgattagtggtagtctcatgcttctcctcggcctgcaatccaaatcccctttattcctttcccgctctcttgcgcttggcgtcagctgttcttaaccttgaacaaattagggtgtcattctagttgcacgtgttcttatccagatgttgggagtgcggtgaactgctgatattctactaaaccgatatcaattatatggatgttcaatttggttcacgtcactaggtaaatgatttcccaccttagaccaaacttaacggataggaaagaacttttggcaagtggcagatccaggtagtttttttccttccctttttctgtaattggcagttacttgttctccaaatacttggaactgctgtgaaaagtttccaattgagccttggaatcaggagcaatggggaactcttctaagttacttgcatttcttctttaaagactcagaaataataagcaagaaacacacatagatctggtgaaacttgagttagcgtgcagtttttaacacctccatgtaccaaggggattcaatggtaaaggcctcatccccttgtcttatctttacttcaagactaaatctgtagctggggaccaagtaccatagtttcgcaactcttatataatccactaggctgctgtgaaaacaatagatgcagtgtttgttttgaagtaagtaaggtgaaagtaaaaatacctggtaatggctaatatgaatcgtggctattattaaatgtttcagcattttctgaataggtaaaccacatatatgtaactatgtaagatgtttttaaatctagatgttctattgagcctgtaacctggtcttttagactagattatgctgagactttgaagaaaaaaatttcagtacattccgtccatcttggacaacctttggacagattattaactctgaatcagtcccatcatgctgcacatgttggatatttcagagtggaccataaagttgcaggcctagtttgctatttttagattttagatcttgtgagttttaatcttgatcatgctattagactcagaatgtgtgtaccaaaaacattgataatggtatctatcctgacttgggtataacttgtgttactggcagctgtgggagggctatgttggcgtagcgtactgaccaagagataatcctctcatcaagtagaatatagagagtagaataattatttatgaaggagatgggcctttatctggctgcagacaaggtgcatagtaaagctcattaaacctctaaaaaaggctggaaatacggcctacggtgtaattgcacattatacatcagttagctaggttggcctccaattttatatggcactttacccttggatgcccatcttatgtattgccatgtactcatgtatgcaattagtcaagaacggcccacttatgccaatatctgtgtaactatgcaatctgttattaccttcttgcacatttactaatttcgctttgtcataatcaggcccaaagtatttccaatgtcgagccctccacctaatccttcgcaacttacaattttctatggtggatcagtatgtgtttatgactcagtgccgccagagaaggtcatattcaccccacttatcttcgttatatcctccgactaactgttgaaagtttatgctaattcgttatctgcaacattgtcatcaacaggctcaagcaatcatgcttattgccgcagcagctgctgcagcggcgtctgccaccaaaagcaatgctgccattgctgttaagccccctgtgatgcctgcagccaatgctacccaagcagcagtctctcctgtgctcacaagatcgctctcattgcagagcacttctgtagcaactggacaacctcaagttgccgctgaccctagctcaatttgcaagctccaggctggtaagactacaagatctttttgtgaatctaaaatggggctgttttaatccctcgtcatatgatgtactaagtgattgaagatgctacaaatttattctttatttgctgtgcagatctccccattgccaggaggcactcccttcagcgcttcctagagaaacgccgtgacaggttggcatgaatgaatgtagaaatagcattctatatttgtctgatgcatttccttaggtttagtggtccattagaacatgctaaaagaatgtggatagctggaaactgacttgtaggggataaaacatttgctttagcttgacttggatacgaaccaagtatatgtgcaaggactgttttcagtttcattaccatagcccatgttttcatgatacataacaaagtagccagtagttatagaaacacagctttctgcaaatttgagaaatccttagcttcaactgattaagccaaatgaccatgttaagcaggttggtgagcaaagctccatatcccacaaaatcctccgagggcatggaagcatcagggatggaagtaactgctgagggcaaggcccagtaactgtcaacttcgaatggtggaggctgacgtttggagggggaaggaaggaaaggcgtcgcgttcattgtttagatggtgtcgcaccctagaaccttactaataatcgaacctatgcccttattatcgttgtactgttccttatgtgctagtctattctgtcatgaatttgtttactcgaacagcaaactgctatgatagtagtatatcattgtacatcatgcatatcattgcctgacaatgttatcgtgttcgtctagtaatgatatcatccaggttaattgttactagt</dnaseqindica>

External Link(s)

NCBI Gene:Os04g0653000, RefSeq:Os04g0653000