Os04g0415000

Please input one-sentence summary here.

Annotated Information

Function

To isolate a rice transferred DNA (T-DNA) insertion mutant, BY240, which exhibited an abaxial leaf curling phenotype that co-segregated with the inserted T-DNA. The T-DNA was inserted in the promoter of a novel gene, ACL1 (Abaxially Curled Leaf 1), and led to overexpression of this gene in BY240. Overexpression of ACL1 in wild-type rice also resulted in abaxial leaf curling. ACL1 encodes a protein of 116 amino acids with no known conserved functional domains. Overexpression of ACL2, the only homolog of ACL1 in rice, also induced abaxial leaf curling. RT–PCR analysis revealed high expressions of ACLs in leaf sheaths and leaf blades, suggesting a role for these genes in leaf development. In situ hybridization revealed non-tissue-specific expression of the ACLs in the shoot apical meristem, leaf primordium, and young leaf. Histological analysis showed increased number and exaggeration of bulliform cells and expansion of epidermal cells in the leaves of BY240, which caused developmental discoordination of the abaxial and adaxial sides, resulting in abaxially curled leaves.

Expression

Please input expression information here.

Evolution

To clone the flanking sequence of the T-DNA in BY240, TAIL–PCR was conducted. To verify the inserting region, primers B4LI and B4RI spanning this region were designed to respectively pair with primers on the T-DNA, namely B4LI coupling with TL and B4RI with TR. In BY240, T-DNA was integrated at position 26 683 bp of PAC clone OJ991214_12 on rice chromosome 4, and the integration resulted in the deletion of a short sequence from the T-DNA region and an 8-bp deletion from the BY240 genome. Furthermore, the inserting region was in the promoter of the predicted gene Os04g33860 (www.tigr.org), 1798 bp upstream of the ATG start codon. We named this putative gene as ACL1. ACL1 comprises two exons and one intron with a full-length cDNA of 1023 bp (Accession: CT831358, Clone Name: OSIGCSN071D21, www.ncgr.ac.cn/ricd/); the first exon is non-coding and the second exon encodes the ACL1 protein of 116 amino acids. Bioinformatics analysis indicated that Os02g33330 (www.tigr.org) in the rice genome was homologous with ACL1 (57.8% protein identity), and was thereby named as ACL2. Similarly, ACL2 is composed of two exons and one intron, and its putative protein of 123 amino acids is encoded by the second exon. In the Arabidopsis genome, two homologous genes, At5g06270 and At3g11600, were found, sharing 48.4 and 38.5% identity with ACL1, respectively. In Vitis vinifera, two homolog proteins, CAO15841 and CAN79170, were identified (Figure 3). However, the function of these ACL proteins remains unknown.

Figure 3. Alignment of Amino Acid Sequences of ACL1 and its Homologies.

The amino acids showing identity were shaded black, whereas similar amino acids were shaded grey. * indicates that region of similarity/identity were from an alignment of 141–261 from CAO15841 and 161–280 from CAN79170 with the corresponding region of ACL1, respectively.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name	Os04g0415000
Description	Conserved hypothetical protein
Version	NM_001059292.1 GI:115458313 GeneID:4335802
Length	942 bp
Definition	Oryza sativa Japonica Group Os04g0415000, complete gene.
Source	Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome	Chromosome 4
Location	Chromosome 4:20530934..20531875
Sequence Coding Region	20531169..20531519
Expression	GEO Profiles:Os04g0415000
Genome Context	<gbrowseImage1> name=NC_008397:20530934..20531875 source=RiceChromosome04 preset=GeneLocation </gbrowseImage1>
Gene Structure	<gbrowseImage2> name=NC_008397:20530934..20531875 source=RiceChromosome04 preset=GeneLocation </gbrowseImage2>
Coding Sequence	<cdnaseq>atgagccgcagcaacaagaagagctctaggggcatcgacctgaagctgaacctctcgctgccggcgagaggggactcgtcgtccaggagggcgatggccgccgacgaggagtcgtcgccgagctcgtgcctgtcgtcggagaacgagcacggcctgcagtggtccaacagcccggaggcgacgtccatggtgctcgccgcctgccctcgctgcttcatctacgtcatgctcccgcaggatgatccgcggtgcccgcagtgcaagagccccgtgatccttgacttcctgcagcaggacaacggcaacaacaacgccaacagcaatagcagcaggaagaccaggagagggtga</cdnaseq>
Protein Sequence	<aaseq>MSRSNKKSSRGIDLKLNLSLPARGDSSSRRAMAADEESSPSSCL SSENEHGLQWSNSPEATSMVLAACPRCFIYVMLPQDDPRCPQCKSPVILDFLQQDNGN NNANSNSSRKTRRG</aaseq>
Gene Sequence	<dnaseqindica>236..586#agcaagaagaccccgagcaattctacccgctcggagctcctcccctttcatcgtctccaatcaccatcatctgcacgtctcaccggccctacgcaacagtaagttccttcgccatcgccatgtcttctcctacctctaagcttcatatgacagtcgtgcaaaagtttccatttgaccaaccggctaacgaacgtttttatgggggtgtaggcaagtgggttacctctcgatcgggatgagccgcagcaacaagaagagctctaggggcatcgacctgaagctgaacctctcgctgccggcgagaggggactcgtcgtccaggagggcgatggccgccgacgaggagtcgtcgccgagctcgtgcctgtcgtcggagaacgagcacggcctgcagtggtccaacagcccggaggcgacgtccatggtgctcgccgcctgccctcgctgcttcatctacgtcatgctcccgcaggatgatccgcggtgcccgcagtgcaagagccccgtgatccttgacttcctgcagcaggacaacggcaacaacaacgccaacagcaatagcagcaggaagaccaggagagggtgaagttaaacaaaagggggggcaattctccgtttggcagaagatcaacatcaatcaagaaaaagaaaagcgtctatatgaagtcctaggtccagtaattctcttttgttttgcctattcccccagtgtaaccatgatatattccttactaaaattgtgagactagcatgaaaatccatgtgctggtggcataattttgatacatcatggatacactggggactatatccatccccctctcctggcttccttctttagtggttctaaatgaagaagttttgcttagacataggaccagacttctcatctttgttttgtttttgtttcctttccgagatgaaaagaaaacatttaccctg</dnaseqindica>
External Link(s)	NCBI Gene:Os04g0415000, RefSeq:Os04g0415000