Os01g0206700

From RiceWiki
Revision as of 06:41, 29 January 2015 by Zhangye (talk | contribs) (Expression)
Jump to: navigation, search

OsCIPK05 is a member of CIPK genes (CIPKs,calcineurin B-like protein interacting protein kinases) in rice[1].

Annotated Information

Function

In the pairs OsCIPK5:OsCIPK13, one of the genes had almost negligible expression exhibiting pseudo-functionalization[2].

Expression

  • OsCIPK05 was induced by drought and ABA treatment[1]. OsCIPK05 showed down-regulation at 2 and 8 h after drought treatment but up-regulation at 4 and 6 h[3].
  • OsCIPK05 showed expression in the leaf, shoot, anther, and stigma/ovary and had a predominant role in these tissues/organs compared to OsCIPK20, except for the mature anther where OsCIPK20 had preferred expression[3]. Under the high salinity conditions, OsCIPK5 was transcriptionally up-regulated only in roots[4].

Evolution

OsCIPK05 belongs to subgroup III of OsCIPK family[3].

Knowledge Extension

  • Calcineurin B-like protein-interacting protein kinases(CIPKs) are a group of typical Ser/Thr protein kinases that mediate calcium signals. Some genes in the CIPK family of rice are involved in the responses to multiple abiotic stresses, whereas some genes of the family are responsive to specific stresses[1].
  • The calcineurin B-like protein–CBL-interacting protein kinase (CBL–CIPK) signaling pathway in plants is a Ca2+-related pathway that responds strongly to both abiotic and biotic environmental stimuli. The CBL-CIPK system shows variety, specificity, and complexity in response to different stresses, and the CBL–CIPK signaling pathway is regulated by complex mechanisms in plant cells[5].
  • As a plant-specific Ca2+ sensor relaying pathway, the CBL–CIPK pathway has some crosstalk with other signaling pathways. In addition, research has shown that there is crosstalk between the CBL–CIPK pathway and the low-K+ response pathway, the ABA signaling pathway, the nitrate sensing and signaling pathway, and others[5].

Labs working on this gene

  • National Center of Plant Gene Research (Wuhan), National Key Laboratory of Crop Genetic Improvement,

Huazhong Agricultural University, Wuhan 430070, China

  • Department of Plant Molecular Systems Biotechnology & Crop Biotech Institute, Kyung Hee University, Yongin 446-701, Korea
  • Graduate School of Biotechnology, Kyung Hee University, Yongin 446-701, Korea
  • State Key Laboratory of Crop Genetics and Germplasm Enhancement, Nanjing Agricultural University, Nanjing 210095, China
  • College of Chemistry and Life Sciences, Zhejiang Normal University, Jinhua 321004, China
  • Department of Plant Molecular Biology, University of Delhi South Campus, Benito Juarez Road, Dhaula Kuan, New Delhi-110021, India

References

  1. 1.0 1.1 1.2 Xiang Y, Huang Y, Xiong L. Characterization of stress-responsive CIPK genes in rice for stress tolerance improvement[J]. Plant physiology, 2007, 144(3): 1416-1428.
  2. Kanwar P, Sanyal S K, Tokas I, et al. Comprehensive structural, interaction and expression analysis of CBL and CIPK complement during abiotic stresses and development in rice[J]. Cell Calcium, 2014.
  3. 3.0 3.1 3.2 Giong H K, Moon S, Jung K H. A systematic view of the rice calcineurin B-like protein interacting protein kinase family[J]. Genes & Genomics, 2015, 37(1): 55-68.
  4. 4.0 4.1 CHEN X, GU Z, LIU F, et al. Molecular Analysis of Rice CIPKs Involved in Biotic and Abiotic Stress Responses[J]. Chinese Journal of Rice Science, 2010, 6: 003.
  5. 5.0 5.1 Yu Q, An L, Li W. The CBL–CIPK network mediates different signaling pathways in plants[J]. Plant cell reports, 2014, 33(2): 203-214.

Structured Information

Gene Name

Os01g0206700

Description

Similar to Serine/threonine protein kinase (CBL-interacting protein kinase 20)

Version

NM_001048880.1 GI:115435173 GeneID:4327093

Length

1922 bp

Definition

Oryza sativa Japonica Group Os01g0206700, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:5808569..5810490

Sequence Coding Region

5808778..5810163

Expression

GEO Profiles:Os01g0206700

Genome Context

<gbrowseImage1> name=NC_008394:5808569..5810490 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:5808569..5810490 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggagaagaaggcgtccatcctcatgaaccggtatgagctcggccgcatgctcgggcaaggcaccttcgccaaggtgtaccatgcacggaaccttgcatccaaccagagcgtcgccatcaaggtcattgacaaggaaaaggtattgcgtgtcggcatgattgaccagatcaagcgagagatctccatcatgcgcctcgttcgccaccccaacatcgtccagctgcacgaggtcatggccagcaagagcaagatatactttgcaatggagtatgtccggggtggtgagctcttcagcagggtagccagggggcgactcaaggaggatgctgcgaggaagtacttccagcagttgataggggctgtggacttctgtcacagccgcggtgtctaccaccgagacctcaagccagagaacctcctcgtcgacgagaatggcaacctcaaagtgtcggactttgggctgagcgccttcaaggagtgtcagaagcaggacgggctgctccacacgacgtgtggcacacctgcatatgttgcaccagagataatcaataagaggggctatgatggagcaaaagcagacatatggtcttgcggtgtcatactctttgttctgcttgctggctacctcccattccatgactcaaatctaatggagatgtaccggaagataagcaaaggtgatgtcaagttcccacagtggttcactactgatgtccgaaggcttctgtccaggctgcttgatccaaatccaaacattaggatcaccgttgagaagctagttgagcatccatggttcaagaaggggtacaaaccagcagtgatgctatcacagccaaatgaatcaaacaacctcaaggatgtccatactgctttcagtgctgatcacaaggacaatgaaggcaaggcaaaagaaccagcaagctctttgaagccagtgagcttgaatgcatttgacatcatctccctctccaaaggatttgatctgtcaggcctgtttgagaacgacaaagagcagaaggcagactcacggttcatgacacaaaaaccagcatcagcaatagtgtcaaagctagagcagattgctgagacagagagcttcaaggtgaagaagcaggatggactggtgaagctccagggatccaaagaagggaggaaagggcagctcgcgatcgatgcagagatctttgaagtgacaccatccttctttgttgttgaggtgaagaagtctgcaggggacacgttggagtacgaaaaattctgcaacaagggcctaagaccttctctcagggacatctgctgggatggtcagtcagagcatccatcactggcacagtcatcaactctgactcagtcctctaagtcaatctcgagacatgccatttaa</cdnaseq>

Protein Sequence

<aaseq>MEKKASILMNRYELGRMLGQGTFAKVYHARNLASNQSVAIKVID KEKVLRVGMIDQIKREISIMRLVRHPNIVQLHEVMASKSKIYFAMEYVRGGELFSRVA RGRLKEDAARKYFQQLIGAVDFCHSRGVYHRDLKPENLLVDENGNLKVSDFGLSAFKE CQKQDGLLHTTCGTPAYVAPEIINKRGYDGAKADIWSCGVILFVLLAGYLPFHDSNLM EMYRKISKGDVKFPQWFTTDVRRLLSRLLDPNPNIRITVEKLVEHPWFKKGYKPAVML SQPNESNNLKDVHTAFSADHKDNEGKAKEPASSLKPVSLNAFDIISLSKGFDLSGLFE NDKEQKADSRFMTQKPASAIVSKLEQIAETESFKVKKQDGLVKLQGSKEGRKGQLAID AEIFEVTPSFFVVEVKKSAGDTLEYEKFCNKGLRPSLRDICWDGQSEHPSLAQSSTLT QSSKSISRHAI</aaseq>

Gene Sequence

<dnaseqindica>328..1713#acaaacacctggcctatttttaggcatcctcttccatctccagagaagtgagccccagcctcatgtcacaagggaagcactagccaccatagaactctctctctttttctccttcctcctaggaggatcccaaatacaccaatcgtgtcttggattttcccaaacacagcgcgcactctcgcccttcacctctcctccctctcacccttccattacatggatcagggagggaggaaggaggcctgaagtggcgcagagtaggcgcttgtaaacaaatccccccatttgcttcttttgcactgaagaatccctgaagaatccagcaggatggagaagaaggcgtccatcctcatgaaccggtatgagctcggccgcatgctcgggcaaggcaccttcgccaaggtgtaccatgcacggaaccttgcatccaaccagagcgtcgccatcaaggtcattgacaaggaaaaggtattgcgtgtcggcatgattgaccagatcaagcgagagatctccatcatgcgcctcgttcgccaccccaacatcgtccagctgcacgaggtcatggccagcaagagcaagatatactttgcaatggagtatgtccggggtggtgagctcttcagcagggtagccagggggcgactcaaggaggatgctgcgaggaagtacttccagcagttgataggggctgtggacttctgtcacagccgcggtgtctaccaccgagacctcaagccagagaacctcctcgtcgacgagaatggcaacctcaaagtgtcggactttgggctgagcgccttcaaggagtgtcagaagcaggacgggctgctccacacgacgtgtggcacacctgcatatgttgcaccagagataatcaataagaggggctatgatggagcaaaagcagacatatggtcttgcggtgtcatactctttgttctgcttgctggctacctcccattccatgactcaaatctaatggagatgtaccggaagataagcaaaggtgatgtcaagttcccacagtggttcactactgatgtccgaaggcttctgtccaggctgcttgatccaaatccaaacattaggatcaccgttgagaagctagttgagcatccatggttcaagaaggggtacaaaccagcagtgatgctatcacagccaaatgaatcaaacaacctcaaggatgtccatactgctttcagtgctgatcacaaggacaatgaaggcaaggcaaaagaaccagcaagctctttgaagccagtgagcttgaatgcatttgacatcatctccctctccaaaggatttgatctgtcaggcctgtttgagaacgacaaagagcagaaggcagactcacggttcatgacacaaaaaccagcatcagcaatagtgtcaaagctagagcagattgctgagacagagagcttcaaggtgaagaagcaggatggactggtgaagctccagggatccaaagaagggaggaaagggcagctcgcgatcgatgcagagatctttgaagtgacaccatccttctttgttgttgaggtgaagaagtctgcaggggacacgttggagtacgaaaaattctgcaacaagggcctaagaccttctctcagggacatctgctgggatggtcagtcagagcatccatcactggcacagtcatcaactctgactcagtcctctaagtcaatctcgagacatgccatttaagtgcaacctcataagagatgcagtaacaatccattttcctctctccttttccctttcatcaaagtgctgagcctgagagtattctcacttgagcatcaggcttagggctctttgatgataatttttgccagttttccttgtatagtagcagtttgtctacatggatctcctgttctttcaccaatagaaacagggagattgacaacagc</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0206700, RefSeq:Os01g0206700