Ipomoea batatas ocimene synthase 2 (OS2) mRNA, complete cds.

---

Seq-submit ::= {
  sub {
    contact {
      contact {
        name name {
          last "Zeng",
          first "Lanting",
          middle "",
          initials "",
          suffix "",
          title ""
        },
        affil std {
          affil "South China Botanical Garden, Chinese Academy of Sciences",
          div "Center of Economic Botany, Core Botanical Gardens",
          city "Guangzhou",
          country "China",
          street "Changxing",
          email "zenglanting@scbg.ac.cn",
          postal-code "510630"
        }
      }
    },
    cit {
      authors {
        names std {
          {
            name name {
              last "Xiao",
              first "Yangyang",
              initials "Y."
            }
          },
          {
            name name {
              last "Qian",
              first "Jiajia",
              initials "J."
            }
          },
          {
            name name {
              last "Hou",
              first "Xingliang",
              initials "X."
            }
          },
          {
            name name {
              last "Zeng",
              first "Lanting",
              initials "L."
            }
          },
          {
            name name {
              last "Liu",
              first "Xu",
              initials "X."
            }
          },
          {
            name name {
              last "Mei",
              first "Guoguo",
              initials "G."
            }
          },
          {
            name name {
              last "Liao",
              first "Yinyin",
              initials "Y."
            }
          }
        },
        affil std {
          affil "South China Botanical Garden, Chinese Academy of Sciences",
          div "Center of Economic Botany, Core Botanical Gardens",
          city "Guangzhou",
          country "China",
          street "Changxing",
          postal-code "510630"
        }
      },
      date std {
        year 2022,
        month 8,
        day 31
      }
    },
    subtype new,
    tool "table2asn 1.26.678"
  },
  data entrys {
    set {
      class nuc-prot,
      descr {
        source {
          org {
            taxname "Ipomoea batatas",
            common "sweet potato",
            db {
              {
                db "taxon",
                tag id 4120
              }
            },
            orgname {
              lineage "Eukaryota; Viridiplantae; Streptophyta; Embryophyta;
 Tracheophyta; Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae;
 Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea",
              gcode 1,
              mgcode 1,
              div "PLN"
            }
          },
          subtype {
            {
              subtype tissue-type,
              name "3-week-old leaf"
            },
            {
              subtype country,
              name "China"
            },
            {
              subtype collection-date,
              name "2021-04-21"
            }
          }
        },
        pub {
          pub {
            gen {
              cit "Unpublished",
              authors {
                names std {
                  {
                    name name {
                      last "Xiao",
                      first "Yangyang",
                      initials "Y."
                    }
                  },
                  {
                    name name {
                      last "Qian",
                      first "Jiajia",
                      initials "J."
                    }
                  },
                  {
                    name name {
                      last "Hou",
                      first "Xingliang",
                      initials "X."
                    }
                  },
                  {
                    name name {
                      last "Zeng",
                      first "Lanting",
                      initials "L."
                    }
                  },
                  {
                    name name {
                      last "Liu",
                      first "Xu",
                      initials "X."
                    }
                  },
                  {
                    name name {
                      last "Mei",
                      first "Guoguo",
                      initials "G."
                    }
                  },
                  {
                    name name {
                      last "Liao",
                      first "Yinyin",
                      initials "Y."
                    }
                  }
                }
              }
            }
          }
        },
        create-date std {
          year 2022,
          month 8,
          day 31
        }
      },
      seq-set {
        seq {
          id {
genbank { accession "C_AA001109", version 1}, gi 0670650650011091
          },
          descr {
 
 user {
  class "1.0",
  type str "AutodefOptions",
  data {
    {label str "UseLabels",data bool TRUE },
    {label str "LeaveParenthetical",data bool TRUE},
    {label str "SpecifyNuclearProduct",data bool TRUE},
    {label str "MaxMods",data int 0},
    {label str "FeatureListType",data str "List All Features"},
    {label str "MiscFeatRule",data str "Delete"},
    {label str "HIVRule",data str "WantBoth"},
    {label str "ModifierList",
	data fields { {label str "OrgMods",num 1,
		data strs {"isolate" }}}}}}, 
  
            molinfo {
              biomol mRNA
            },
            user {
              type str "Submission",
              data {
                {
                  label str "AdditionalComment",
                  data str "ALT EMAIL:zenglanting@scbg.ac.cn"
                }
              }
            },
            user {
              type str "Submission",
              data {
                {
                  label str "AdditionalComment",
                  data str "Submission Title:None"
                }
              }
            }
          },
          inst {
            repr raw,
            mol rna,
            length 1533,
            topology linear,
            seq-data ncbi2na '3A2880B9A2C43A382EF8F694E90B9F81C3338AE4887AA7E9
4DBFE08E133E8277E022CBF5DCCA1F8433CF9E4D17482EEB7EFF427FD0A00EBFE1B7742137F253
74E8E00E883F3D614C4038C70AA3CE2FCCE0976FDD37D8688013DF40F9C25FFF0C0397420CD3A0
0A087925FDE08AC0D395F810512C7321750AFA094AEB33E293B28010AAF30E1FFD7627E719E8FD
04EB10DD0CD222075082ED0AEBA02132A724A40F09FEE22323CBA2EF1B3A927A2F11541641D242
9D93297040AFDE4F0D1043E38CDCE3BF3A3754381D45CFC40EFBC00BA8DF8E8B808DF533C4E00C
EFD7E77710C4B038BEA338C5BC089082C0F431531F9000BA9233BB824F7EBA0907E832420AF114
5DF0AECDF8C19FABF7B76A8BBCF7F44E7CFDFAD1D004D143824F2397E4830438DF708EB4D4E3FD
65CE438DC905FC2DA23A26AB807903D0CF3B44E0202E847C8218F46A1CCC633F1F8E093A083703
001004DE30C33F76BFA8253F3E09243C37E760FDD2E47C524688EABE89D68C52340037ADF35F8F
3D853E97E4EA428E00'H
          },
          annot {
            {
              data ftable {
                {
                  id local id 2,
                  data gene {
                    locus "OS2"
                  },
                  location int {
                    from 0,
                    to 1532,
                    strand plus,
                    id gi 0670650650011091
                  },
                  xref {
                    {
                      id local id 1
                    }
                  }
                }
              }
            }
          }
        },
        seq {
          id {
genbank { accession "C_AAA00819", version 1}, gi 067065065065008191
          },
          descr {
            title "ocimene synthase 2 [Ipomoea batatas]",
            molinfo {
              biomol peptide,
              tech concept-trans
            }
          },
          inst {
            repr raw,
            mol aa,
            length 510,
            seq-data iupacaa "MEEKVRSTMDEVLIRPWQVLELIYEVQRLGLGHRFEDDILEALERVVS
SIGLDNIIAASPQKCGLVFKLFKENGFDVSQDIFSHLMDENGEFIPTIQNDTKGIMSLYEASFLIFDGENILQIAKPF
LIKCLKNIMEKEDCSLSEEVNHALEQPQYYRPPRLEARWYIEACRKTRGYNDFFLELATLDFNMVQSQYQRELQEVSR
WWKDIGLAGKLSFVRDRLVECYVWAAGVTPQPQLSKARIGLTKVSALITTIDDIYDVYGSPNELHLFTNVVKKWDLDG
VKDLPYYMKICFLALYNTVNELGYDTVKEQEVNSIPILAKKWADMCEAFLVEATWNSKKVTPPLKVYLDNAWVSVSGS
VILSHAYFLVTQNITNEALDALQNNNDLLRWSSMIFRLCNDLATFKSEMERGETANSILCHMKESGHLEDDSRDYIRY
LLDEAWKNLNKNKTSDNNISRFGKPFIEAAINLARISQCTYQHGDGVGAPDTRSKNLVLSLIIRPLALHGQG"
          },
          annot {
            {
              data ftable {
                {
                  data prot {
                    name {
                      "ocimene synthase 2"
                    }
                  },
                  location int {
                    from 0,
                    to 509,
                    id gi 067065065065008191
                  }
                }
              }
            }
          }
        }
      },
      annot {
        {
          data ftable {
            {
              id local id 1,
              data cdregion {
                frame one,
                code {
                  id 1
                }
              },
              product whole gi 067065065065008191,
              location int {
                from 0,
                to 1532,
                strand plus,
                id gi 0670650650011091
              },
              xref {
                {
                  id local id 2
                }
              }
            }
          }
        }
      }
    }
  }
}