Salmonella enterica DNA polymerase III subunit beta (dnaN) gene, partial cds.
Seq-submit ::= {
sub {
contact {
contact {
name name {
last "Zhao",
first "Meiyuan",
middle "",
initials "",
suffix "",
title ""
},
affil std {
affil "Southwest University",
div "college of veterinary medicine",
city "chongqing",
country "China",
street "tiansheng street",
email "1904196089@qq.com",
postal-code "400715"
}
}
},
cit {
authors {
names std {
{
name name {
last "Zhao",
first "Meiyuan",
initials "M."
}
}
},
affil std {
affil "Southwest University",
div "college of veterinary medicine",
city "chongqing",
country "China",
street "tiansheng street",
postal-code "400715"
}
},
date std {
year 2024,
month 3,
day 26
}
},
subtype new,
tool "table2asn 1.28.943"
},
data entrys {
set {
class genbank,
seq-set {
set {
class nuc-prot,
descr {
source {
org {
taxname "Salmonella enterica",
db {
{
db "taxon",
tag id 28901
}
},
orgname {
mod {
{
subtype strain,
subname "CQJLP2021TS013"
},
{
subtype nat-host,
subname "Chinemys reevesii"
}
},
lineage "Bacteria; Proteobacteria; Gammaproteobacteria;
Enterobacterales; Enterobacteriaceae; Salmonella",
gcode 11,
mgcode 0,
div "BCT"
}
},
subtype {
{
subtype country,
name "China"
},
{
subtype isolation-source,
name "feces"
}
}
},
user {
type str "StructuredComment",
data {
{
label str "StructuredCommentPrefix",
data str "##Assembly-Data-START##"
},
{
label str "Sequencing Technology",
data str "Sanger dideoxy sequencing"
},
{
label str "StructuredCommentSuffix",
data str "##Assembly-Data-END##"
}
}
},
create-date std {
year 2024,
month 3,
day 26
}
},
seq-set {
seq {
id {
genbank { accession "C_AA063741", version 1}, gi 0670650650637411
},
descr {
user {
class "1.0",
type str "AutodefOptions",
data {
{label str "UseLabels",data bool TRUE },
{label str "LeaveParenthetical",data bool TRUE},
{label str "SpecifyNuclearProduct",data bool TRUE},
{label str "MaxMods",data int 0},
{label str "FeatureListType",data str "List All Features"},
{label str "MiscFeatRule",data str "Delete"},
{label str "HIVRule",data str "WantBoth"},
{label str "ModifierList",
data fields { {label str "OrgMods",num 1,
data strs {"isolate" }}}}}},
molinfo {
biomol genomic
},
user {
type str "Submission",
data {
{
label str "AdditionalComment",
data str "GenBase"
}
}
}
},
inst {
repr raw,
mol dna,
length 743,
topology linear,
seq-data ncbi2na '567A9ADB5C67963DDAC179D752B2686B19FDDE169163
7E03A23AD999BC67F74964E25AB9C716E5A6680F7F8CDE59A5E5A2A6688F96F4BE8298DA39EB9B
DE96C967DD9EDC67979658FD5837E187A40982F83F19E59294638265E3E09854BFD8E9D34A3B99
C71F01ACE7BF8068292607991EF98786945B7A6BB9D0E59E8A6DFC549476B8FB966C0A6E3E078E
6CE7E1AE98015BE66E48DA4B0C3359991B6987F37F17609EBA3AD9F568F16D9BDE5820D68C04DE
826A798CD7424A6C'H
},
annot {
{
data ftable {
{
id local id 2,
data gene {
locus "dnaN"
},
partial TRUE,
location int {
from 1,
to 729,
strand plus,
id gi 0670650650637411,
fuzz-from lim lt,
fuzz-to lim gt
},
xref {
{
id local id 1
}
}
}
}
}
}
},
seq {
id {
genbank { accession "C_AAG78435", version 1}, gi 067065065071784351
},
descr {
title "DNA polymerase III subunit beta, partial [Salmonella
enterica]",
molinfo {
biomol peptide,
tech concept-trans,
completeness no-ends
}
},
inst {
repr raw,
mol aa,
length 243,
seq-data iupacaa "PLGGRPTLPILGNLLLQVADGTLSLTGTDLEMEMVARVTLSQPH
EPGATTVPARKFFDICRGLPEGAEIAVQLEGDRMLVRSGRSRFSLSTLPAADFPNLDDWQSEVEFTLPQATMKRLIEA
TQFSMAHQDVRYYLNGMLFETEGSELRTVATDGHRLAVCSMPLEASLPSHSVIVPRKGVIELMRMLDGGENPLRVQIG
SNNIRAHVGDFIFTSKLVDGRFPDYRRVLPKNPDKHLEAGCDI"
},
annot {
{
data ftable {
{
data prot {
name {
"DNA polymerase III subunit beta"
}
},
partial TRUE,
location int {
from 0,
to 242,
id gi 067065065071784351,
fuzz-from lim lt,
fuzz-to lim gt
}
}
}
}
}
}
},
annot {
{
data ftable {
{
id local id 1,
data cdregion {
frame one,
code {
id 11
}
},
partial TRUE,
product whole gi 067065065071784351,
location int {
from 1,
to 729,
strand plus,
id gi 0670650650637411,
fuzz-from lim lt,
fuzz-to lim gt
},
xref {
{
id local id 2
}
}
}
}
}
}
}
}
}
}
}