Salmonella enterica Uroporphyrinogen III synthase (hemD) gene, partial cds.

---

Seq-submit ::= {
  sub {
    contact {
      contact {
        name name {
          last "Zhao",
          first "Meiyuan",
          middle "",
          initials "",
          suffix "",
          title ""
        },
        affil std {
          affil "Southwest University",
          div "college of veterinary medicine",
          city "chongqing",
          country "China",
          street "tiansheng street",
          email "1904196089@qq.com",
          postal-code "400715"
        }
      }
    },
    cit {
      authors {
        names std {
          {
            name name {
              last "Zhao",
              first "Meiyuan",
              initials "M."
            }
          }
        },
        affil std {
          affil "Southwest University",
          div "college of veterinary medicine",
          city "chongqing",
          country "China",
          street "tiansheng street",
          postal-code "400715"
        }
      },
      date std {
        year 2024,
        month 3,
        day 26
      }
    },
    subtype new,
    tool "table2asn 1.28.943"
  },
  data entrys {
    set {
      class genbank,
      seq-set {
        set {
          class nuc-prot,
          descr {
            source {
              org {
                taxname "Salmonella enterica",
                db {
                  {
                    db "taxon",
                    tag id 28901
                  }
                },
                orgname {
                  mod {
                    {
                      subtype strain,
                      subname "CQBB2021DS144"
                    },
                    {
                      subtype nat-host,
                      subname "Canis lupus familiaris"
                    }
                  },
                  lineage "Bacteria; Proteobacteria; Gammaproteobacteria;
 Enterobacterales; Enterobacteriaceae; Salmonella",
                  gcode 11,
                  mgcode 0,
                  div "BCT"
                }
              },
              subtype {
                {
                  subtype country,
                  name "China"
                },
                {
                  subtype isolation-source,
                  name "feces"
                }
              }
            },
            user {
              type str "StructuredComment",
              data {
                {
                  label str "StructuredCommentPrefix",
                  data str "##Assembly-Data-START##"
                },
                {
                  label str "Sequencing Technology",
                  data str "Sanger dideoxy sequencing"
                },
                {
                  label str "StructuredCommentSuffix",
                  data str "##Assembly-Data-END##"
                }
              }
            },
            create-date std {
              year 2024,
              month 3,
              day 26
            }
          },
          seq-set {
            seq {
              id {
genbank { accession "C_AA063981", version 1}, gi 0670650650639811
              },
              descr {

 user {
  class "1.0",
  type str "AutodefOptions",
  data {
    {label str "UseLabels",data bool TRUE },
    {label str "LeaveParenthetical",data bool TRUE},
    {label str "SpecifyNuclearProduct",data bool TRUE},
    {label str "MaxMods",data int 0},
    {label str "FeatureListType",data str "List All Features"},
    {label str "MiscFeatRule",data str "Delete"},
    {label str "HIVRule",data str "WantBoth"},
    {label str "ModifierList",
        data fields { {label str "OrgMods",num 1,
                data strs {"isolate" }}}}}},
  
                molinfo {
                  biomol genomic
                },
                user {
                  type str "Submission",
                  data {
                    {
                      label str "AdditionalComment",
                      data str "GenBase"
                    }
                  }
                }
              },
              inst {
                repr raw,
                mol dna,
                length 592,
                topology linear,
                seq-data ncbi2na '78F83FB65ADA89C5457A58597A619E1A00637AFFE57F
449196D97F9D19527526A3A5807A5EED96673F663E96451A67657D316F26AF633DBCD4FA36A034
9825F9C43C5E0F100CF9A901999E3FE6E90E9A5981E7A98057849D9A2582D2FFEE0EF3418EE601
3C63A6682098E67A4C7669B0419FBED149A623BE41A77AD9E1D58BACDB891EBC719EDA73EB6D2E
06DE9917656A07A9E9'H
              },
              annot {
                {
                  data ftable {
                    {
                      id local id 2,
                      data gene {
                        locus "hemD"
                      },
                      partial TRUE,
                      location int {
                        from 8,
                        to 577,
                        strand plus,
                        id gi 0670650650639811,
                        fuzz-from lim lt,
                        fuzz-to lim gt
                      },
                      xref {
                        {
                          id local id 1
                        }
                      }
                    }
                  }
                }
              }
            },
            seq {
              id {
genbank { accession "C_AAG78675", version 1}, gi 067065065071786751
              },
              descr {
                title "Uroporphyrinogen III synthase, partial [Salmonella
 enterica]",
                molinfo {
                  biomol peptide,
                  tech concept-trans,
                  completeness no-ends
                }
              },
              inst {
                repr raw,
                mol aa,
                length 190,
                seq-data iupacaa "FVAGRELPTLADRLATLTENDLVFALSQHAVAFAHAQLQRDGRN
WPVSPRYFAIGRTTALALHTVSGFDIRYPLDREISEALLQLPELQNIAGKRALILRGNGGRELLGETLTARGAEVSFC
ECYQRCAKHYDGAEEAMRWHTRGVTTLVVTSGEMLQRLWSLTPEWYREHWLLRCRLLVVSERLAHLAR"
              },
              annot {
                {
                  data ftable {
                    {
                      data prot {
                        name {
                          "Uroporphyrinogen III synthase"
                        }
                      },
                      partial TRUE,
                      location int {
                        from 0,
                        to 189,
                        id gi 067065065071786751,
                        fuzz-from lim lt,
                        fuzz-to lim gt
                      }
                    }
                  }
                }
              }
            }
          },
          annot {
            {
              data ftable {
                {
                  id local id 1,
                  data cdregion {
                    frame two,
                    code {
                      id 11
                    }
                  },
                  partial TRUE,
                  product whole gi 067065065071786751,
                  location int {
                    from 8,
                    to 577,
                    strand plus,
                    id gi 0670650650639811,
                    fuzz-from lim lt,
                    fuzz-to lim gt
                  },
                  xref {
                    {
                      id local id 2
                    }
                  }
                }
              }
            }
          }
        }
      }
    }
  }
}