Quaranjavirus isolate Culex/Museum14/2023/Quaranjavirus-2:segment:1 PB2 (PB2) gene, partial cds.

---

Seq-submit ::= {
  sub {
    contact {
      contact {
        name name {
          last "Xia",
          first "Han",
          middle "",
          initials "",
          suffix "",
          title ""
        },
        affil std {
          affil "Wuhan Institute of Virology, Chinese Academy of Sciences",
          div "Microbial Resource and Bioinformatic Center",
          city "Wuhan",
          country "China",
          street "NO.44 Xiaohongshan",
          email "hanxia@wh.iov.cn",
          postal-code "430071"
        }
      }
    },
    cit {
      authors {
        names std {
          {
            name name {
              last "Xia",
              first "Han",
              initials "H."
            }
          }
        },
        affil std {
          affil "Wuhan Institute of Virology, Chinese Academy of Sciences",
          div "Microbial Resource and Bioinformatic Center",
          city "Wuhan",
          sub "Hubei",
          country "China",
          street "NO.44 Xiaohongshan",
          postal-code "430071"
        }
      },
      date std {
        year 2025,
        month 7,
        day 15
      }
    },
    subtype new,
    tool "table2asn 1.28.1094"
  },
  data entrys {
    set {
      class nuc-prot,
      descr {
        source {
          org {
            taxname "Quaranjavirus",
            orgname {
              mod {
                {
                  subtype isolate,
                  subname "Culex/Museum14/2023/Quaranjavirus-2:segment:1"
                },
                {
                  subtype nat-host,
                  subname "Culex; Host_sex: UNKNOWN"
                },
                {
                  subtype metagenome-source,
                  subname "mosquito metagenome"
                }
              },
              gcode 1
            }
          },
          subtype {
            {
              subtype country,
              name "Kenya: Museum"
            },
            {
              subtype environmental-sample,
              name ""
            },
            {
              subtype collection-date,
              name "2023"
            },
            {
              subtype metagenomic,
              name ""
            }
          }
        },
        user {
          type str "StructuredComment",
          data {
            {
              label str "StructuredCommentPrefix",
              data str "##Assembly-Data-START##"
            },
            {
              label str "Assembly Method",
              data str "Megahit v. 1.2.9"
            },
            {
              label str "Sequencing Technology",
              data str "Illumina"
            },
            {
              label str "StructuredCommentSuffix",
              data str "##Assembly-Data-END##"
            }
          }
        },
        create-date std {
          year 2025,
          month 7,
          day 15
        }
      },
      seq-set {
        seq {
          id {
genbank { accession "C_AA111787", version 1}, gi 0670650651117871
          },
          descr {

        user {
            class "1.0",
            type str "AutodefOptions",
            data {
                {label str "UseLabels", data bool TRUE},
                {label str "LeaveParenthetical", data bool TRUE},
                {label str "SpecifyNuclearProduct", data bool TRUE},
                {label str "MaxMods", data int 0},
                {label str "FeatureListType", data str "List All Features"},
                {label str "MiscFeatRule", data str "Delete"},
                {label str "HIVRule", data str "WantBoth"},
                {label str "ModifierList",
                    data fields { {label str "OrgMods", num 1,
                            data strs {"isolate" }}}}}},
        
            molinfo {
              biomol genomic
            },
            user {
              type str "Submission",
              data {
                {
                  label str "AdditionalComment",
                  data str "GenBase"
                }
              }
            }
          },
          inst {
            repr raw,
            mol rna,
            length 1040,
            topology linear,
            strand ss,
            seq-data ncbi4na '418214412228422148882122282488122211441118842881
888824221242488282882822828421218448224848828212228141842824484228222488228141
841848184241411428244124418242842884421488141242444142441288821841218414414142
888241241444212148824144148414248221482188842848411884214141422844148481211441
248128114114228181844428222884222821448448411448221144842848488228222221141144
224418414184821841118421111221482411224111188281212281248444214141412148242848
441481824144421221281212488848224441244114242828141114218211142122142444282144
428282228212141148228884214418842848288218211421214184442248414411444144488441
414418424211441112121441841248411411414422284441888828412441448214241428412188
841121841181888414142148814428414841114288244118248241188218222141448422412824
188222218481824214412248418411884422228218211481841144144882818218211148441211
422441211428222848428441241412842428F28441214218428428448414221828412822828442
211188414411418448288488881218411211841211881284841418448141424442181221141241
88444148441141124144421821414184414821284414211121114144'H
          },
          annot {
            {
              data ftable {
                {
                  id local id 2,
                  data gene {
                    locus "PB2"
                  },
                  partial TRUE,
                  location int {
                    from 0,
                    to 1039,
                    strand plus,
                    id gi 0670650651117871,
                    fuzz-from lim lt,
                    fuzz-to lim gt
                  },
                  xref {
                    {
                      id local id 1
                    }
                  }
                },
                {
                  id local id 3,
                  data rna {
                    type mRNA,
                    ext name "PB2"
                  },
                  partial TRUE,
                  location int {
                    from 0,
                    to 1039,
                    strand plus,
                    id gi 0670650651117871,
                    fuzz-from lim lt,
                    fuzz-to lim gt
                  },
                  xref {
                    {
                      data gene {
                        locus "PB2"
                      }
                    },
                    {
                      id local id 1
                    }
                  }
                }
              }
            }
          }
        },
        seq {
          id {
genbank { accession "C_AAL25487", version 1}, gi 067065065076254871
          },
          descr {
            title "MAG: PB2, partial [Quaranjavirus]",
            molinfo {
              biomol peptide,
              tech concept-trans,
              completeness no-ends
            }
          },
          inst {
            repr raw,
            mol aa,
            length 346,
            seq-data iupacaa "IRTLPVSPSLPKEIAYFRHAFSSPLHMVRVLTLDARCLPFLDDVCEKL
GRIAAWQLDAGADFHDMRRAFDEGTVRGVSVQSFAVNCREPGVYKDVLRSLYGLPCPQVVKVQGAVFLPQEGRMRCHE
MQNQSNRKFYTYVGRETVAVEYRGHHYTFVRDGSALESIKAPAGSGLSLTEVLCRIAVFIKHRWAVRKGGLERMRKET
QDDVKKRPWDFLTEVSELTFEHEYLRAVRLSESFGIVEFIPEVPTRFPMYRRTVMNWPLIKYEGGSIIKVDKPDKLPV
LDETALLDSMLLVSHLTPLAKLRKMVLFYMNNDNYCEMVERAYQDDWEWKNEGIRDGVTGANKE"
          },
          annot {
            {
              data ftable {
                {
                  data prot {
                    name {
                      "PB2"
                    }
                  },
                  partial TRUE,
                  location int {
                    from 0,
                    to 345,
                    id gi 067065065076254871,
                    fuzz-from lim lt,
                    fuzz-to lim gt
                  }
                }
              }
            }
          }
        }
      },
      annot {
        {
          data ftable {
            {
              id local id 1,
              data cdregion {
                frame two,
                code {
                  id 1
                }
              },
              partial TRUE,
              product whole gi 067065065076254871,
              location int {
                from 0,
                to 1039,
                strand plus,
                id gi 0670650651117871,
                fuzz-from lim lt,
                fuzz-to lim gt
              },
              xref {
                {
                  id local id 2
                },
                {
                  id local id 3
                }
              }
            }
          }
        }
      }
    }
  }
}